DHX9/RNA Helicase A Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4563
Zusätzliche Namen:: DDX9|DHX9/RNA Helicase A|LKP|NDH2|NDHII|RHA
Anwendung:: ELISA, WB, IHC-P, IF, ICC, IP
Molekulargewicht:: 141kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ITGLRAAMEALVVEVTKQPAIISQLDPVNERMLNMIRQISRPSAAGINLMIGSTRYGDGPRPPKMARYDNGSGYRRGGSSYSGGGYGGGYSSGGYGSGGYG
Uniprot:: Q08211
Synonyme:: ATP-dependent RNA helicase A;DDX9;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9;DEAH (Asp-Glu-Ala-His) box helicase 9;DEAH (Asp-Glu-Ala-His) box polypeptide 9;DEAH box protein 9;DEAH-box helicase 9;DExH-box helicase 9;leukophysin;LKP;NDH2;NDHII;nuclear DNA helicase II;RHA;RNA helicase A
Weitere Details:: This gene encodes a member of the DEAH-containing family of RNA helicases. The encoded protein is an enzyme that catalyzes the ATP-dependent unwinding of double-stranded RNA and DNA-RNA complexes. This protein localizes to both the nucleus and the cytoplasm and functions as a transcriptional regulator. This protein may also be involved in the expression and nuclear export of retroviral RNAs. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 11 and 13.