A4553
PAK2 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A4553
- Zusätzliche Namen:
- KNO2|p58|PAK-2|PAK2|PAK65|PAKgamma|S6/H4 kinase
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 58-61kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPE
- Uniprot:
- Q13177
- Synonyme:
- gamma-PAK;p21 (CDKN1A)-activated kinase 2;p21 protein (Cdc42/Rac)-activated kinase 2;p21-activated kinase 2;p58;PAK-2;PAK65;PAKgamma;S6/H4 kinase;serine/threonine-protein kinase PAK 2
- Weitere Details:
- The p21 activated kinases (PAK) are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. The PAK proteins are a family of serine/threonine kinases that serve as targets for the small GTP binding proteins, CDC42 and RAC1, and have been implicated in a wide range of biological activities. The protein encoded by this gene is activated by proteolytic cleavage during caspase-mediated apoptosis, and may play a role in regulating the apoptotic events in the dying cell.
- Versandbedingungen:
- Blue Ice







