A4535
RARB Beta Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A4535
- Zusätzliche Namen:
- HAP|MCOPS12|NR1B2|RARbeta|RARbeta1|RARB Beta|RRB2
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
- Uniprot:
- P10826
- Synonyme:
- HAP;HBV-activated protein;hepatitis B virus activated protein;MCOPS12;NR1B2;nuclear receptor subfamily 1 group B member 2;RAR-beta;RAR-epsilon;RARbeta1;retinoic acid receptor beta;retinoic acid receptor, beta polypeptide;RRB2
- Weitere Details:
- This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. Alternate promoter usage and differential splicing result in multiple transcript variants.
- Versandbedingungen:
- Blue Ice