Aconitase 2 (ACO2) Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4524
Zusätzliche Namen:: Aconitase 2 (ACO2)|ACONM|HEL-S-284|ICRD|OCA8|OPA9
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 85kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEV
Uniprot:: Q99798
Synonyme:: aconitase 2, mitochondrial;aconitate hydratase, mitochondrial;ACONM;citrate hydro-lyase;epididymis secretory sperm binding protein Li 284;HEL-S-284;ICRD;mitochondrial aconitase;OCA8;OPA9
Weitere Details:: The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.