A4502
PRMT1 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A4502
- Zusätzliche Namen:
- ANM1|HCP1|HRMT1L2|IR1B4|PRMT1
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 42kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTG
- Uniprot:
- Q99873
- Synonyme:
- ANM1;HCP1;heterogeneous nuclear ribonucleoprotein methyltransferase 1-like 2;histone-arginine N-methyltransferase PRMT1;HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 2;HRMT1L2;interferon receptor 1-bound protein 4;IR1B4;protein arginine N-methyltransferase 1
- Weitere Details:
- This gene encodes a member of the protein arginine N-methyltransferase (PRMT) family. Post-translational modification of target proteins by PRMTs plays an important regulatory role in many biological processes, whereby PRMTs methylate arginine residues by transferring methyl groups from S-adenosyl-L-methionine to terminal guanidino nitrogen atoms. The encoded protein is a type I PRMT and is responsible for the majority of cellular arginine methylation activity. Increased expression of this gene may play a role in many types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5.
- Versandbedingungen:
- Blue Ice








