LEF1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4473
Zusätzliche Namen:: LEF-1|LEF1|TCF10|TCF1ALPHA|TCF7L3
Anwendung:: ELISA, WB
Molekulargewicht:: 25-58kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHA
Uniprot:: Q9UJU2
Synonyme:: LEF-1;lymphoid enhancer-binding factor 1;T cell-specific transcription factor 1-alpha;TCF1-alpha;TCF10;TCF1ALPHA;TCF7L3
Weitere Details:: This gene encodes a transcription factor belonging to a family of proteins that share homology with the high mobility group protein-1. The protein encoded by this gene can bind to a functionally important site in the T-cell receptor-alpha enhancer, thereby conferring maximal enhancer activity. This transcription factor is involved in the Wnt signaling pathway, and it may function in hair cell differentiation and follicle morphogenesis. Mutations in this gene have been found in somatic sebaceous tumors. This gene has also been linked to other cancers, including androgen-independent prostate cancer. Alternative splicing results in multiple transcript variants.