[KO Validated] PEPCK/PCK2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4466
Zusätzliche Namen:: K2|PEPCK|PEPCK-M|PEPCK2
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 71kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVHKM
Uniprot:: Q16822
Synonyme:: epididymis secretory sperm binding protein;PEP carboxykinase;PEPCK;PEPCK-M;PEPCK2;phosphoenolpyruvate carboxykinase [GTP], mitochondrial;phosphopyruvate carboxylase
Weitere Details:: This gene encodes a mitochondrial enzyme that catalyzes the conversion of oxaloacetate to phosphoenolpyruvate in the presence of guanosine triphosphate (GTP). A cytosolic form of this protein is encoded by a different gene and is the key enzyme of gluconeogenesis in the liver. Alternatively spliced transcript variants have been described.