A4461
EDAR Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A4461
- Zusätzliche Namen:
- DL|ECTD10A|ECTD10B|ED1R|ED3|ED5|EDA-A1R|EDA1R|EDA3|EDAR|HRM1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 48kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKELSGQGHLATA
- Uniprot:
- Q9UNE0
- Synonyme:
- anhidrotic ectodysplasin receptor 1;DL;downless homolog;downless, mouse, homolog of;ECTD10A;ECTD10B;ectodermal dysplasia receptor;ectodysplasin 1, anhidrotic receptor;Ectodysplasin-A receptor;ED1R;ED3;ED5;EDA-A1 receptor;EDA-A1R;EDA1R;EDA3;HRM1;tumor necrosis factor receptor superfamily member EDAR
- Weitere Details:
- This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia.
- Versandbedingungen:
- Blue Ice

