A4460
SENP1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A4460
- Zusätzliche Namen:
- SENP1|SuPr-2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 73kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VTVVQETQKKGHKLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFFTKL
- Uniprot:
- Q9P0U3
- Synonyme:
- sentrin-specific protease 1;sentrin/SUMO-specific protease SENP1;SUMO1/sentrin specific peptidase 1;SUMO1/sentrin specific protease 1;SuPr-2
- Weitere Details:
- This gene encodes a cysteine protease that specifically targets members of the small ubiquitin-like modifier (SUMO) protein family. This protease regulates SUMO pathways by deconjugating sumoylated proteins. This protease also functions to process the precursor SUMO proteins into their mature form. Alternate splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice