USP10 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4454
Zusätzliche Namen:: MGC2621|UBP10|UBPO|USP10
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MALHSPQYIFGDFSPDEFNQFFVTPRSSVELPPYSGTVLCGTQAVDKLPDGQEYQRIEFGVDEVIEPSDTLPRTPSYSISSTLNPQAPEFILGCTASKIT
Uniprot:: Q14694
Synonyme:: deubiquitinating enzyme 10;ubiquitin carboxyl-terminal hydrolase 10;ubiquitin specific protease 10;ubiquitin thioesterase 10;ubiquitin thiolesterase 10;ubiquitin-specific-processing protease 10;UBPO
Weitere Details:: Ubiquitin is a highly conserved protein that is covalently linked to other proteins to regulate their function and degradation. This gene encodes a member of the ubiquitin-specific protease family of cysteine proteases. The enzyme specifically cleaves ubiquitin from ubiquitin-conjugated protein substrates. The protein is found in the nucleus and cytoplasm. It functions as a co-factor of the DNA-bound androgen receptor complex, and is inhibited by a protein in the Ras-GTPase pathway. The human genome contains several pseudogenes similar to this gene. Several transcript variants, some protein-coding and others not protein-coding, have been found for this gene.