GNB5 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A4447
Zusätzliche Namen:: GB5|gbeta5|GNB5|HG2E|IDDCA|LADCI
Anwendung:: ELISA, WB
Molekulargewicht:: 39kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLC
Uniprot:: O14775
Synonyme:: G protein, beta subunit 5L;GB5;gbeta5;guanine nucleotide binding protein (G protein), beta 5;guanine nucleotide-binding protein subunit beta-5;guanine nucleotide-binding protein, beta subunit 5L;IDDCA;LADCI;transducin beta chain 5
Weitere Details:: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. Alternatively spliced transcript variants encoding different isoforms exist.