A4418
RBM14 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A4418
- Zusätzliche Namen:
- COAA|PSP2|RBM14|SIP|SYTIP1|TMEM137
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 75kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRS
- Uniprot:
- Q96PK6
- Synonyme:
- COAA;COAZ;paraspeckle protein 2;PSP2;RBM14;RBM14-RBM4 protein;RBM14/RBM4 fusion;RNA-binding motif protein 14;RNA-binding protein 14;RRM-containing coactivator activator/modulator;SIP;synaptotagmin-interacting protein;SYT-interacting protein;SYTIP1;TMEM137;transcriptional coactivator CoAZ;transmembrane protein 137
- Weitere Details:
- This gene encodes a ribonucleoprotein that functions as a general nuclear coactivator, and an RNA splicing modulator. This protein contains two RNA recognition motifs (RRM) at the N-terminus, and multiple hexapeptide repeat domain at the C-terminus that interacts with thyroid hormone receptor-binding protein (TRBP), and is required for transcription activation. Alternatively spliced transcript variants encoding different isoforms (with opposing effects on transcription) have been described for this gene.
- Versandbedingungen:
- Blue Ice

