NUMA1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4416
Zusätzliche Namen:: NMP-22|NUMA|NUMA1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 238kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TPESKKATSCFPRPMTPRDRHEGRKQSTTEAQKKAAPASTKQADRRQSMAFSILNTPKKLGNSLLRRGASKKALSKASPNTRSGTRRSPRIATTTASAATA
Uniprot:: Q14980
Synonyme:: centrophilin stabilizes mitotic spindle in mitotic cells;NMP-22;nuclear matrix protein-22;Nuclear mitotic apparatus protein;nuclear mitotic apparatus protein 1;NUMA;SP-H antigen;structural nuclear protein
Weitere Details:: This gene encodes a large protein that forms a structural component of the nuclear matrix. The encoded protein interacts with microtubules and plays a role in the formation and organization of the mitotic spindle during cell division. Chromosomal translocation of this gene with the RARA (retinoic acid receptor, alpha) gene on chromosome 17 have been detected in patients with acute promyelocytic leukemia. Alternative splicing results in multiple transcript variants.