DKC1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4407
Zusätzliche Namen:: CBF5|DKC|DKC1|DKCX|NAP57|NOLA4|XAP101
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDK
Uniprot:: O60832
Synonyme:: CBF5;CBF5 homolog;DKC;DKCX;dyskeratosis congenita 1, dyskerin;Dyskerin;H/ACA ribonucleoprotein complex subunit 4;H/ACA ribonucleoprotein complex subunit DKC1;NAP57;NOLA4;nopp140-associated protein of 57 kDa;nucleolar protein family A member 4;nucleolar protein NAP57;snoRNP protein DKC1;XAP101
Weitere Details:: This gene functions in two distinct complexes. It plays an active role in telomerase stabilization and maintenance, as well as recognition of snoRNAs containing H/ACA sequences which provides stability during biogenesis and assembly into H/ACA small nucleolar RNA ribonucleoproteins (snoRNPs). This gene is highly conserved and widely expressed, and may play additional roles in nucleo-cytoplasmic shuttling, DNA damage response, and cell adhesion. Mutations have been associated with X-linked dyskeratosis congenita. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice