[KD Validated] glucose-6-phosphate isomerase Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4401
Zusätzliche Namen:: [KD Validated] glucose-6-phosphate isomerase|AMF|GNPI|NLK|PGI|PHI|SA-36|SA36
Anwendung:: ELISA, WB
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLH
Uniprot:: P06744
Synonyme:: AMF;autocrine motility factor;glucose-6-phosphate isomerase;GNPI;hexose monophosphate isomerase;hexosephosphate isomerase;neuroleukin;NLK;oxoisomerase;PGI;PHI;phosphoglucose isomerase;phosphohexomutase;phosphohexose isomerase;phosphosaccharomutase;SA-36;SA36;Sperm antigen 36;sperm antigen-36
Weitere Details:: This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phosphate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice