SF3A1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A4399
Zusätzliche Namen:: PRP21|PRPF21|SAP114|SF3A1|SF3A120
Anwendung:: ELISA, WB
Molekulargewicht:: 130kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLAL
Uniprot:: Q15459
Synonyme:: pre-mRNA processing 21;pre-mRNA splicing factor SF3a (120 kDa subunit);PRP21;PRPF21;SAP 114;SAP114;SF3A120;spliceosome-associated protein 114;splicing factor 3 subunit 1;splicing factor 3A subunit 1;splicing factor 3a, subunit 1, 120kD;splicing factor 3a, subunit 1, 120kDa
Weitere Details:: This gene encodes a subunit of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer is a component of the mature U2 small nuclear ribonucleoprotein particle (snRNP). U2 small nuclear ribonucleoproteins play a critical role in spliceosome assembly and pre-mRNA splicing.