A4369
PQBP1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A4369
- Zusätzliche Namen:
- MRX2|MRX55|MRXS3|MRXS8|NPW38|PQBP1|RENS1|SHS
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 30kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD
- Uniprot:
- O60828
- Synonyme:
- 38 kDa nuclear protein containing a WW domain;MRX2;MRX55;MRXS3;MRXS8;NPW38;polyglutamine tract-binding protein 1;polyglutamine-binding protein 1;RENS1;SHS
- Weitere Details:
- This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
- Versandbedingungen:
- Blue Ice