A4368
USH1C Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A4368
- Zusätzliche Namen:
- USH1C|zgc:136806
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 73kDa
- Spezies-Reaktivität:
- Fish
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MERKVAREFRHKVELLIDNEAEKDYLYDVLRMYHQSMDLPVLVGDLKLVINEPKRLPLFDAIRPLIPLKHQVQYDQLTPKRSRKLKEVRLDRTHPEGLGL
- Synonyme:
- AIE-75;antigen NY-CO-38/NY-CO-37;autoimmune enteropathy-related antigen AIE-75;DFNB18;DFNB18A;ha;harmonin;harmonin pseudogene;NY-CO-37;NY-CO-38;PDZ-45;PDZ-73;PDZ-73/NY-CO-38;PDZ73;PDZD7C;renal carcinoma antigen NY-REN-3;ush1cpst;Usher syndrome 1C (autosomal recessive, severe);usher syndrome type-1C protein;zgc:136806
- Weitere Details:
- Predicted to enable actin filament binding activity. Acts upstream of or within neuron development; startle response; and synapse organization. Predicted to be part of stereocilia ankle link complex. Predicted to be active in several cellular components, including cilium; photoreceptor inner segment; and stereocilium tip. Is expressed in brain; hair cell; pleuroperitoneal region; sensory system; and trunk musculature. Used to study Usher syndrome. Human ortholog(s) of this gene implicated in Usher syndrome; Usher syndrome type 1; Usher syndrome type 1C; and autosomal recessive nonsyndromic deafness 18A. Orthologous to human USH1C (USH1 protein network component harmonin).
- Versandbedingungen:
- Blue Ice