A4352
LYVE1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A4352
- Zusätzliche Namen:
- CRSBP-1|HAR|LYVE-1|LYVE1|XLKD1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 33kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRI
- Uniprot:
- Q9Y5Y7
- Synonyme:
- cell surface retention sequence binding protein-1;Cell surface retention sequence-binding protein 1;CRSBP-1;extracellular link domain-containing 1;extracellular link domain-containing protein 1;HAR;hyaluronic acid receptor;lymphatic vessel endothelial hyaluronic acid receptor 1;LYVE-1;XLKD1
- Weitere Details:
- This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.
- Versandbedingungen:
- Blue Ice