A4348
SUZ12 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A4348
- Zusätzliche Namen:
- CHET9|IMMAS|JJAZ1|SUZ12
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 83kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQI
- Uniprot:
- Q15022
- Synonyme:
- chET 9 protein;CHET9;chromatin precipitated E2F target 9 protein;IMMAS;JJAZ1;joined to JAZF1 protein;polycomb protein SUZ12;suppressor of zeste 12 protein homolog
- Weitere Details:
- This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gene contains a zinc finger domain in the C terminus of the coding region.
- Versandbedingungen:
- Blue Ice