[KO Validated] TRIM25 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4347
Zusätzliche Namen:: 25|EFP|RNF147|Z147|ZNF147
Anwendung:: ELISA, WB
Molekulargewicht:: 70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SPNAQVACDHCLKEAAVKTCLVCMASFCQEHLQPHFDSPAFQDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSECICHICLVEHKTCSPASLSQASADLEA
Uniprot:: Q14258
Synonyme:: E3 ubiquitin/ISG15 ligase TRIM25;EFP;estrogen-responsive finger protein;RING finger protein 147;RING-type E3 ubiquitin transferase;RING-type E3 ubiquitin transferase TRIM25;RNF147;tripartite motif protein TRIM25;tripartite motif-containing protein 25;ubiquitin/ISG15-conjugating enzyme TRIM25;Z147;Zinc finger protein 147;zinc finger protein 147 (estrogen-responsive finger protein);zinc finger protein-147;ZNF147
Weitere Details:: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein is an RNA binding protein, functions as a ubiquitin E3 ligase and is involved in multiple cellular processes, including regulation of antiviral innate immunity.