Calcineurin A Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4346
Zusätzliche Namen:: ACCIID|Calcineurin A|CALN|CALNA|CALNA1|CCN1|CNA1|DEE91|IECEE|IECEE1|PPP2B
Anwendung:: ELISA, WB
Molekulargewicht:: 59 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ
Uniprot:: Q08209
Synonyme:: ACCIID;calcineurin A alpha;Calmodulin-dependent calcineurin A subunit alpha isoform;CALN;CALNA;CALNA1;CAM-PRP catalytic subunit;CCN1;CNA1;DEE91;IECEE;IECEE1;PPP2B;protein phosphatase 3 catalytic subunit alpha isozyme;serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
Weitere Details:: Enables several functions, including ATPase binding activity; calmodulin binding activity; and calmodulin-dependent protein phosphatase activity. Involved in several processes, including calcineurin-NFAT signaling cascade; peptidyl-serine dephosphorylation; and response to calcium ion. Located in several cellular components, including cytosol; dendritic spine; and nucleoplasm. Part of calcineurin complex. Colocalizes with cytoplasmic side of plasma membrane. Implicated in developmental and epileptic encephalopathy 91. Biomarker of focal segmental glomerulosclerosis and schizophrenia.

Versandbedingungen:: Blue Ice