PGC1 beta Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4331
Zusätzliche Namen:: ERRL1|PERC|PGC-1(beta)|PGC1 beta|PGC1B
Anwendung:: ELISA, WB
Molekulargewicht:: 113kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH
Uniprot:: Q86YN6
Synonyme:: ERRL1;PERC;peroxisome proliferator-activated receptor gamma coactivator 1-beta;peroxisome proliferator-activated receptor gamma, coactivator 1 beta;PGC-1-related estrogen receptor alpha coactivator;PGC-1(beta);PGC1B;PPAR-gamma coactivator 1-beta;PPARgamma coactivator 1 beta;PPARGC-1-beta
Weitere Details:: The protein encoded by this gene stimulates the activity of several transcription factors and nuclear receptors, including estrogen receptor alpha, nuclear respiratory factor 1, and glucocorticoid receptor. The encoded protein may be involved in fat oxidation, non-oxidative glucose metabolism, and the regulation of energy expenditure. This protein is downregulated in prediabetic and type 2 diabetes mellitus patients. Certain allelic variations in this gene increase the risk of the development of obesity. Three transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice