PDIA4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A4326
Zusätzliche Namen:: ERp-72|ERP70|ERP72|PDIA4
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 72kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFL
Uniprot:: P13667
Synonyme:: endoplasmic reticulum resident protein 70;endoplasmic reticulum resident protein 72;ER protein 70;ER protein 72;ERp-72;ERP70;ERP72;protein disulfide isomerase related protein (calcium-binding protein, intestinal-related);protein disulfide isomerase-associated 4;protein disulfide-isomerase A4;testicular tissue protein Li 137
Weitere Details:: This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, three catalytically active thioredoxin (TRX) domains, two TRX-like domains and a C-terminal ER-retention sequence. This protein, when bound to cyclophilin B, enhances the rate of immunoglobulin G intermolecular disulfide bonding and antibody assembly.