A4308
Peroxiredoxin 2 (PRDX2) Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A4308
- Zusätzliche Namen:
- HEL-S-2a|NKEF-B|NKEFB|Peroxiredoxin 2 (PRDX2)|PRP|PRX2|PRXII|PTX1|TDPX1|TPX1|TSA
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 22kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLN
- Uniprot:
- P32119
- Synonyme:
- epididymis secretory sperm binding protein Li 2a;HEL-S-2a;natural killer cell-enhancing factor B;NKEF-B;NKEFB;peroxiredoxin-2;PRP;PRX2;PRXII;PTX1;TDPX1;thiol-specific antioxidant 1;Thiol-specific antioxidant protein;thioredoxin peroxidase 1;thioredoxin-dependent peroxide reductase 1;thioredoxin-dependent peroxiredoxin 2;torin;TPX1;TSA
- Weitere Details:
- This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of CD8(+) T-cells. The crystal structure of this protein has been resolved to 2.7 angstroms. This protein prevents hemolytic anemia from oxidative stress by stabilizing hemoglobin, thus making this gene a therapeutic target for patients with hemolytic anemia. This protein may have a proliferative effect and play a role in cancer development or progression. Related pseudogenes have been identified on chromosomes 5, 6, 10 and 13.
- Versandbedingungen:
- Blue Ice