A4290
SNAP29 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A4290
- Zusätzliche Namen:
- CEDNIK|SNAP-29|SNAP29
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 29kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL
- Uniprot:
- O95721
- Synonyme:
- CEDNIK;cerebral dysgenesis, neuropathy, ichthyosis and keratoderma syndrome;SNAP-29;soluble 29 kDa NSF attachment protein;synaptosomal-associated protein 29;synaptosomal-associated protein, 29kD;synaptosomal-associated protein, 29kDa;synaptosome associated protein 29kDa;vesicle-membrane fusion protein SNAP-29
- Weitere Details:
- This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene.
- Versandbedingungen:
- Blue Ice



