A4286
Peroxiredoxin 6 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A4286
- Zusätzliche Namen:
- 1-Cys|aiPLA2|AOP2|HEL-S-128m|LPCAT-5|NSGPx|p29|Peroxiredoxin 6|PRX
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 25kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
- Uniprot:
- P30041
- Synonyme:
- 1-Cys;1-Cys peroxiredoxin;1-Cys PRX;24 kDa protein;acidic calcium-independent phospholipase A2;aiPLA2;antioxidant protein 2;AOP2;epididymis secretory sperm binding protein Li 128m;glutathione-dependent peroxiredoxin;HEL-S-128m;liver 2D page spot 40;LPC acyltransferase 5;LPCAT-5;lyso-PC acyltransferase 5;lysophosphatidylcholine acyltransferase 5;non-selenium glutathione peroxidase;NSGPx;p29;peroxiredoxin-6;PRX;red blood cells page spot 12
- Weitere Details:
- The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.
- Versandbedingungen:
- Blue Ice