ESRRA Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4176
Zusätzliche Namen:: ERR1|ERRa|ERRalpha|ESRL1|ESRRA|NR3B1
Anwendung:: ELISA, WB
Molekulargewicht:: 48-50kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACK
Uniprot:: P11474
Synonyme:: ERR-alpha;ERR1;ERRa;ERRalpha;ESRL1;estrogen receptor-like 1;estrogen-related nuclear receptor alpha;Estrogen-related receptor alpha;NR3B1;nuclear receptor subfamily 3 group B member 1;steroid hormone receptor ERR1
Weitere Details:: The protein encoded by this gene is a nuclear receptor that is most closely related to the estrogen receptor. This protein acts as a site-specific transcription factor and interacts with members of the PGC-1 family of transcription cofactors to regulate the expression of most genes involved in cellular energy production as well as in the process of mitochondrial biogenesis. A processed pseudogene of ESRRA is located on chromosome 13q12.1.