A4168
MSMB Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A4168
- Zusätzliche Namen:
- HPC13|IGBF|MSMB|MSP|MSPB|PN44|PRPS|PSP|PSP-94|PSP57|PSP94
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 17kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEK
- Uniprot:
- P08118
- Synonyme:
- beta-microseminoprotein;HPC13;IGBF;immunoglobulin binding factor;Immunoglobulin-binding factor;MSP;MSPB;PN44;prostate secreted seminal plasma protein;prostate secretory protein of 94 amino acids;PRPS;PSP;PSP-94;PSP57;PSP94;seminal plasma beta-inhibin
- Weitere Details:
- The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene.
- Versandbedingungen:
- Blue Ice