A4138
Prostatic Acid Phosphatase (ACPP) Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A4138
- Zusätzliche Namen:
- 5'-NT|ACP-3|ACPP|Prostatic Acid Phosphatase (ACPP)|TM-PAP
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 45 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRKRYRKFLNESYKHE
- Uniprot:
- P15309
- Synonyme:
- 5'-NT;5'-nucleotidase;acid phosphatase, prostate;ACP-3;ACPP;ecto-5'-nucleotidase;prostatic acid phosphatase;prostatic acid phosphotase;protein tyrosine phosphatase ACP3;thiamine monophosphatase;TM-PAP;TMPase
- Weitere Details:
- This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland. An alternatively spliced transcript variant encoding a longer isoform has been found for this gene. This isoform contains a transmembrane domain and is localized in the plasma membrane-endosomal-lysosomal pathway.
- Versandbedingungen:
- Blue Ice