A4117
SLC20A1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A4117
- Zusätzliche Namen:
- Glvr-1|GLVR1|PiT-1|PIT1|SLC20A1
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 70-100kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPN
- Uniprot:
- Q8WUM9
- Synonyme:
- gibbon ape leukemia virus receptor 1;Glvr-1;GLVR1;leukemia virus receptor 1 homolog;Phosphate transporter 1;PiT-1;PIT1;sodium-dependent phosphate transporter 1;solute carrier family 20 (phosphate transporter), member 1;Solute carrier family 20 member 1
- Weitere Details:
- The protein encoded by this gene is a sodium-phosphate symporter that absorbs phosphate from interstitial fluid for use in cellular functions such as metabolism, signal transduction, and nucleic acid and lipid synthesis. The encoded protein is also a retroviral receptor, causing human cells to be susceptible to infection by gibbon ape leukemia virus, simian sarcoma-associated virus, feline leukemia virus subgroup B, and 10A1 murine leukemia virus.
- Versandbedingungen:
- Blue Ice