TMEFF2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4116
Zusätzliche Namen:: CT120.2|HPP1|TENB2|TMEFF2|TPEF|TR|TR-2
Anwendung:: ELISA, WB
Molekulargewicht:: 41kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: HGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNRIHRQKQNTGHYSSDNTTRASTRLI
Uniprot:: Q9UIK5
Synonyme:: cancer/testis antigen family 120, member 2;CT120.2;HPP1;hyperplastic polyposis protein 1;TENB2;tomoregulin-2;TPEF;TR;TR-2;transmembrane protein TENB2;transmembrane protein with EGF-like and two follistatin-like domains
Weitere Details:: This gene encodes a member of the tomoregulin family of transmembrane proteins. This protein has been shown to function as both an oncogene and a tumor suppressor depending on the cellular context and may regulate prostate cancer cell invasion. Multiple soluble forms of this protein have been identified that arise from both an alternative splice variant and ectodomain shedding. Additionally, this gene has been found to be hypermethylated in multiple cancer types. Alternative splicing results in multiple transcript variants.