SH3GL3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A4112
Zusätzliche Namen:: CNSA3|EEN-B2|HsT19371|SH3D2C|SH3GL3|SH3P13
Anwendung:: ELISA, WB
Molekulargewicht:: 39kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGV
Uniprot:: Q99963
Synonyme:: CNSA3;EEN-B2;endophilin-3;endophilin-A3;HsT19371;SH3 domain containing GRB2 like endophilin A3;SH3 domain protein 2C;SH3 domain-containing GRB2-like protein 3;SH3-domain GRB2-like 3;SH3D2C;SH3P13
Weitere Details:: Enables identical protein binding activity. Predicted to be involved in synaptic vesicle uncoating. Predicted to be located in acrosomal vesicle; early endosome membrane; and presynapse. Predicted to be part of early endosome. Predicted to be active in glutamatergic synapse; postsynaptic density, intracellular component; and postsynaptic endosome.