A4084
CD48 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A4084
- Zusätzliche Namen:
- BCM1|BLAST|BLAST1|CD48|hCD48|mCD48|MEM-102|SLAMF2
- Anwendung:
- ELISA, Flow Cytometry, WB
- Molekulargewicht:
- 46kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS
- Uniprot:
- P09326
- Synonyme:
- B-lymphocyte activation marker BLAST-1;BCM1;BCM1 surface antigen;BLAST;BLAST1;CD48 antigen;CD48 antigen (B-cell membrane protein);hCD48;leukocyte antigen MEM-102;mCD48;MEM-102;signaling lymphocytic activation molecule 2;SLAM family member 2;SLAMF2;TCT.1
- Weitere Details:
- This gene encodes a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins. The encoded protein is found on the surface of lymphocytes and other immune cells, dendritic cells and endothelial cells, and participates in activation and differentiation pathways in these cells. The encoded protein does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice