A4081
RBPJK Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A4081
- Zusätzliche Namen:
- AOS3|CBF-1|CBF1|csl|IGKJRB|IGKJRB1|KBF2|RBP-J|RBP-J kappa|RBP-JK|RBPJK|RBPSUH|SUH
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 60 kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- CAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVST
- Uniprot:
- Q06330
- Synonyme:
- AOS3;CBF-1;CBF1;csl;H-2K binding factor-2;IGKJRB;IGKJRB1;immunoglobulin kappa J region recombination signal binding protein 1;J kappa-recombination signal-binding protein;KBF2;RBP-J;RBP-J kappa;RBP-JK;RBPJK;RBPSUH;recombining binding protein suppressor of hairless;renal carcinoma antigen NY-REN-30;SUH;suppressor of hairless homolog
- Weitere Details:
- The protein encoded by this gene is a transcriptional regulator important in the Notch signaling pathway. The encoded protein acts as a repressor when not bound to Notch proteins and an activator when bound to Notch proteins. It is thought to function by recruiting chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins to Notch signaling pathway genes. Several transcript variants encoding different isoforms have been found for this gene, and several pseudogenes of this gene exist on chromosome 9.
- Versandbedingungen:
- Blue Ice