PGE receptor EP3 (PTGER3) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A4057
Zusätzliche Namen:: EP3|EP3-I|EP3-II|EP3-III|EP3-IV|EP3-VI|EP3e|lnc003875|PGE receptor EP3 (PTGER3)|PGE2-R
Anwendung:: ELISA, WB
Molekulargewicht:: 50kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVA
Uniprot:: P43115
Synonyme:: EP3;EP3-I;EP3-II;EP3-III;EP3-IV;EP3-VI;EP3e;lnc003875;PGE receptor, EP3 subtype;PGE2 receptor EP3 subtype;PGE2-R;prostaglandin E receptor 3 (subtype EP3);prostaglandin E2 receptor EP3 subtype;prostaglandin receptor (PGE-2);prostanoid EP3 receptor
Weitere Details:: The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple transcript variants encoding different isoforms have been found for this gene.