A4027
DARPP32 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A4027
- Zusätzliche Namen:
- DARPP-32|DARPP32
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 32kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQ
- Uniprot:
- Q9UD71
- Synonyme:
- DARPP-32;DARPP32;dopamine and cAMP-regulated neuronal phosphoprotein 32;Dopamine- and cAMP-regulated neuronal phosphoprotein;protein phosphatase 1 regulatory subunit 1B
- Weitere Details:
- This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

