A3985
NDUFS6 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A3985
- Zusätzliche Namen:
- CI-13kA|CI-13kD-A|CI13KDA|MC1DN9|NDUFS6
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH
- Uniprot:
- O75380
- Synonyme:
- CI-13kA;CI-13kD-A;CI13KDA;complex I 13kDa subunit A;Complex I-13kD-A;complex I, mitochondrial respiratory chain, 13-kD subunit;MC1DN9;NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase);NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial;NADH-ubiquinone oxidoreductase 13 kDa-A subunit;NADH:ubiquinone oxidoreductase NDUFS6 subunit
- Weitere Details:
- This gene encodes a subunit of the NADH:ubiquinone oxidoreductase (complex I), which is the first enzyme complex in the electron transport chain of mitochondria. This complex functions in the transfer of electrons from NADH to the respiratory chain. The subunit encoded by this gene is one of seven subunits in the iron-sulfur protein fraction. Mutations in this gene cause mitochondrial complex I deficiency, a disease that causes a wide variety of clinical disorders, including neonatal disease and adult-onset neurodegenerative disorders.
- Versandbedingungen:
- Blue Ice