LXRA Alpha Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3974
Zusätzliche Namen:: LXR-a|LXRA|LXRA Alpha|RLD-1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 50 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSV
Uniprot:: Q13133
Synonyme:: liver X nuclear receptor alpha variant 1;Liver X receptor alpha;LXR-a;LXRA;Nuclear receptor subfamily 1 group H member 3;oxysterols receptor LXR-alpha;RLD-1
Weitere Details:: The protein encoded by this gene belongs to the NR1 subfamily of the nuclear receptor superfamily. The NR1 family members are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. This protein is highly expressed in visceral organs, including liver, kidney and intestine. It forms a heterodimer with retinoid X receptor (RXR), and regulates expression of target genes containing retinoid response elements. Studies in mice lacking this gene suggest that it may play an important role in the regulation of cholesterol homeostasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.