A3940
KRT81 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A3940
- Zusätzliche Namen:
- ghHkb1|Hb-1|HB1|hHAKB2-1|K81|KRT81|KRTHB1|MLN137
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VAQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEGIGAVNVCVSSSRGGVVCGDLCVSGSRPVTG
- Uniprot:
- Q14533
- Synonyme:
- ghHkb1;hair keratin K2.9;hard keratin, type II, 1;Hb-1;HB1;hHAKB2-1;K81;keratin 81, type II;Keratin-81;keratin, hair, basic, 1;keratin, type II cuticular Hb1;KRTHB1;metastatic lymph node 137 gene protein;MLN137;type II hair keratin Hb1;type-II keratin Kb21
- Weitere Details:
- The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this hair keratin, as well as KRTHB3 and KRTHB6, is found primarily in the hair cortex. Mutations in this gene and KRTHB6 have been observed in patients with a rare dominant hair disease, monilethrix.
- Versandbedingungen:
- Blue Ice

