A3905
GSTM3 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A3905
- Zusätzliche Namen:
- GST5|GSTB|GSTM3|GSTM3-3|GSTM3TV2|GTM3|hGSTM3-3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 25kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
- Uniprot:
- P21266
- Synonyme:
- brain GST;brain type mu-glutathione S-transferase;epididymis secretory sperm binding protein;glutathione S-alkyltransferase M3;glutathione S-aralkyltransferase M3;glutathione S-aryltransferase M3;glutathione S-transferase M3 (brain);glutathione S-transferase Mu 3;glutathione S-transferase mu 3 (brain);glutathione S-transferase, Mu-3;GST class-mu 3;GST5;GSTB;GSTM3-3;GTM3;hGSTM3-3;S-(hydroxyalkyl)glutathione lyase M3
- Weitere Details:
- Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Mutations of this class mu gene have been linked with a slight increase in a number of cancers, likely due to exposure with environmental toxins. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

