TCP1 alpha Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3887
Zusätzliche Namen:: CCT-alpha|CCT1|CCTa|D6S230E|TCP-1-alpha|TCP1 alpha
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAEL
Uniprot:: P17987
Synonyme:: CCT-alpha;CCT1;CCTa;D6S230E;t-complex 1 protein;T-complex protein 1 subunit alpha;T-complex protein 1, alpha subunit;tailless complex polypeptide 1;TCP-1-alpha
Weitere Details:: The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found.