MYLK Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3835
Zusätzliche Namen:: AAT7|KRP|MLCK|MLCK1|MLCK108|MLCK210|MMIHS|MMIHS1|MSTP083|MYLK|MYLK-L|MYLK1|smMLCK
Anwendung:: ELISA, WB
Molekulargewicht:: 130kDa/140kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE
Uniprot:: Q15746
Synonyme:: AAT7;kinase-related protein;KRP;MLCK;MLCK1;MLCK108;MLCK210;MMIHS;MMIHS1;MSTP083;MYLK1;myosin light chain kinase, smooth muscle;myosin, light polypeptide kinase;smMLCK;smooth muscle myosin light chain kinase;telokin
Weitere Details:: This gene, a muscle member of the immunoglobulin gene superfamily, encodes myosin light chain kinase which is a calcium/calmodulin dependent enzyme. This kinase phosphorylates myosin regulatory light chains to facilitate myosin interaction with actin filaments to produce contractile activity. This gene encodes both smooth muscle and nonmuscle isoforms. In addition, using a separate promoter in an intron in the 3' region, it encodes telokin, a small protein identical in sequence to the C-terminus of myosin light chain kinase, that is independently expressed in smooth muscle and functions to stabilize unphosphorylated myosin filaments. A pseudogene is located on the p arm of chromosome 3. Four transcript variants that produce four isoforms of the calcium/calmodulin dependent enzyme have been identified as well as two transcripts that produce two isoforms of telokin. Additional variants have been identified but lack full length transcripts.

Versandbedingungen:: Blue Ice