DYNC1I1 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A3833
Zusätzliche Namen:: DNCI1|DNCIC1|DYNC1I1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 73kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISPEPPLVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVESKVGQDSELENQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRT
Uniprot:: O14576
Synonyme:: cytoplasmic dynein 1 intermediate chain 1;cytoplasmic dynein intermediate chain 1;DH IC-1;DNCI1;DNCIC1;dynein intermediate chain 1, cytosolic;dynein, cytoplasmic, intermediate polypeptide 1
Weitere Details:: Enables spectrin binding activity. Involved in vesicle transport along microtubule. Located in several cellular components, including kinetochore; recycling endosome; and spindle pole.