A3827
DDB1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A3827
- Zusätzliche Namen:
- DDB1|DDBA|UV-DDB1|WHIKERS|XAP1|XPCE|XPE|XPE-BF
- Anwendung:
- ELISA, WB, IHC-P, IP
- Molekulargewicht:
- 127kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
- Uniprot:
- Q16531
- Synonyme:
- damage-specific DNA binding protein 1, 127kDa;Damage-specific DNA-binding protein 1;DDB p127 subunit;DDBA;DNA damage-binding protein 1;DNA damage-binding protein a;HBV X-associated protein 1;UV-damaged DNA-binding factor;UV-damaged DNA-binding protein 1;UV-DDB 1;UV-DDB1;WHIKERS;XAP-1;XAP1;xeroderma pigmentosum group E-complementing protein;XPCE;XPE;XPE-BF;XPE-binding factor
- Weitere Details:
- The protein encoded by this gene is the large subunit (p127) of the heterodimeric DNA damage-binding (DDB) complex while another protein (p48) forms the small subunit. This protein complex functions in nucleotide-excision repair and binds to DNA following UV damage. Defective activity of this complex causes the repair defect in patients with xeroderma pigmentosum complementation group E (XPE) - an autosomal recessive disorder characterized by photosensitivity and early onset of carcinomas. However, it remains for mutation analysis to demonstrate whether the defect in XPE patients is in this gene or the gene encoding the small subunit. In addition, Best vitelliform mascular dystrophy is mapped to the same region as this gene on 11q, but no sequence alternations of this gene are demonstrated in Best disease patients. The protein encoded by this gene also functions as an adaptor molecule for the cullin 4 (CUL4) ubiquitin E3 ligase complex by facilitating the binding of substrates to this complex and the ubiquitination of proteins.
- Versandbedingungen:
- Blue Ice








