CYLD Rabbit polyclonal antibody

Größe

£152.00

SKU:: A3821
Zusätzliche Namen:: BRSS|CDMT|CYLD|CYLD1|CYLDI|EAC|FTDALS8|MFT|MFT1|SBS|TEM|USPL2
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 107kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
Uniprot:: Q9NQC7
Synonyme:: BRSS;CDMT;CYLD1;CYLDI;cylindromatosis (turban tumor syndrome);deubiquitinating enzyme CYLD;EAC;FTDALS8;MFT;MFT1;probable ubiquitin carboxyl-terminal hydrolase CYLD;SBS;TEM;ubiquitin carboxyl-terminal hydrolase CYLD;ubiquitin specific peptidase like 2;ubiquitin thioesterase CYLD;ubiquitin thiolesterase CYLD;ubiquitin-specific-processing protease CYLD;USPL2
Weitere Details:: This gene is encodes a cytoplasmic protein with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains that functions as a deubiquitinating enzyme. Mutations in this gene have been associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Versandbedingungen:: Blue Ice