TREX1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A3819
Zusätzliche Namen:: AGS1|CRV|DRN3|HERNS|RVCLS|TREX1
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 33kDa/34kd
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AFCVDSITALKALERASSPSEHGPRKSYSLGSIYTRLYGQSPPDSHTAEGDVLALLSICQWRPQALLRWVDAHARPFGTIRPMYGVTASARTKPRPSAVTTTAHLATTRNTSPSLGESRGTKDLPPVKDPGALSREGLLAPLGLLAILTLAVATLYGLSLATPGE
Uniprot:: Q9NSU2
Synonyme:: 3' repair exonuclease 1;3'-5' exonuclease TREX1;AGS1;CRV;deoxyribonuclease III;DNase III;DRN3;HERNS;RVCLS;three-prime repair exonuclease 1
Weitere Details:: This gene encodes a nuclear protein with 3' exonuclease activity. The encoded protein may play a role in DNA repair and serve as a proofreading function for DNA polymerase. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, Cree encephalitis, and other diseases of the immune system. Alternative splicing results in multiple transcript variants.