A3808
RACK1 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A3808
- Zusätzliche Namen:
- Gnb2-rs1|GNB2L1|H12.3|HLC-7|PIG21|RACK1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 32kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW
- Uniprot:
- P63244
- Synonyme:
- cell proliferation-inducing gene 21 protein;Gnb2-rs1;GNB2L1;guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1;guanine nucleotide binding protein beta polypeptide 2-like 1;guanine nucleotide-binding protein subunit beta-2-like 1;guanine nucleotide-binding protein subunit beta-like protein 12.3;H12.3;HLC-7;human lung cancer oncogene 7 protein;lung cancer oncogene 7;PIG21;proliferation-inducing gene 21;protein homologous to chicken B complex protein, guanine nucleotide binding;Receptor for activated C kinase;receptor of activated protein C kinase 1;receptor of activated protein kinase C 1;small ribosomal subunit protein RACK1
- Weitere Details:
- Enables several functions, including cyclin binding activity; enzyme binding activity; and protein domain specific binding activity. Involved in several processes, including positive regulation of hydrolase activity; regulation of cellular protein metabolic process; and regulation of signal transduction. Located in several cellular components, including midbody; perinuclear region of cytoplasm; and phagocytic cup. Part of IRE1-RACK1-PP2A complex.
- Versandbedingungen:
- Blue Ice



