A3784
CETN1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A3784
- Zusätzliche Namen:
- CEN1|CETN|CETN1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 20kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
- Uniprot:
- Q12798
- Synonyme:
- calcium binding protein;caltractin;Caltractin isoform 2;CEN1;centrin-1;centrin, EF-hand protein, 1;CETN;EF-hand protein;testicular tissue protein Li 37
- Weitere Details:
- The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle.
- Versandbedingungen:
- Blue Ice