A3758
GRM5 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A3758
- Zusätzliche Namen:
- GPRC1E|GRM5|mGlu5|MGLUR5|PPP1R86
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 150 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAGAQAAGDAARESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTL
- Uniprot:
- P41594
- Synonyme:
- glutamate receptor, metabotropic 5;GPRC1E;metabotropic glutamate receptor 5;mGlu5;MGLUR5;PPP1R86;protein phosphatase 1, regulatory subunit 86
- Weitere Details:
- This gene encodes a member of the G-protein coupled receptor 3 protein family. The encoded protein is a metabatropic glutamate receptor, whose signaling activates a phosphatidylinositol-calcium second messenger system. This protein may be involved in the regulation of neural network activity and synaptic plasticity. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. A pseudogene of this gene has been defined on chromosome 11. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice